General Information

  • ID:  hor000672
  • Uniprot ID:  Q9N0T2(82-118)
  • Protein name:  Calcitonin gene-related peptide 1
  • Gene name:  CALCA
  • Organism:  Equus caballus (Horse)
  • Family:  Calcitonin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Equus (genus), Equidae (family), Perissodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SCNTASCLTHRLAGLLSSAGSMANSNLLPTEMGFKVS
  • Length:  37(82-118)
  • Propeptide:  MGFWKFSPFLPLSILVLYQVGIIQAAPFRSALESLPDPAVLPEEESRLLLAALVKDYVQMKVRALEQEQETGGASITAQKRSCNTASCLTHRLAGLLSSAGSMANSNLLPTEMGFKVSGRRRRDLQA
  • Signal peptide:  MGFWKFSPFLPLSILVLYQVGIIQA
  • Modification:  T37 Serine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role. It also elevates platelet cAMP
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  CALCR
  • Target Unid:  F6YHG4
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45695
  • Structure ID:  AF-Q9N0T2-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000672_AF2.pdbhor000672_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 441263 Formula: C157H262N46O53S4
Absent amino acids: DIQWY Common amino acids: S
pI: 8.24 Basic residues: 3
Polar residues: 18 Hydrophobic residues: 12
Hydrophobicity: 26.22 Boman Index: -2951
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 81.89
Instability Index: 4261.35 Extinction Coefficient cystines: 125
Absorbance 280nm: 3.47

Literature

  • PubMed ID:  12581884
  • Title:  Molecular Cloning and Expression of Equine Calcitonin, Calcitonin Gene-Related peptide-I, and Calcitonin Gene-Related peptide-II